Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerotonin (5-HT) receptor
LigandBDBM50435344
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1550136
Ki 501±n/a nM
Citation Cozzi NVDaley PF Receptor binding profiles and quantitative structure-affinity relationships of some 5-substituted-N,N-diallyltryptamines. Bioorg Med Chem Lett 26:959-64 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Serotonin (5-HT) receptor
Name:Serotonin (5-HT) receptor
Synonyms:5-HT-1E | 5-HT1E | 5-Hydroxytryptamine Receptor Subtype 1E (5HT1E) | 5-hydroxytryptamine receptor 1E | 5-hydroxytryptamine receptor 1E (5-HT-1E) (S31) | 5-hydroxytryptamine receptor 1E (5-HT-1E) (Serotonin receptor 1E) (5-HT1E) (S31). | S31 | Serotonin 1e (5-HT1e) receptor | Serotonin Receptor 1E
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:41697.80
Organism:Homo sapiens (Human)
Description:gi_112822
Residue:365
Sequence:
MNITNCTTEASMAIRPKTITEKMLICMTLVVITTLTTLLNLAVIMAIGTTKKLHQPANYL
ICSLAVTDLLVAVLVMPLSIIYIVMDRWKLGYFLCEVWLSVDMTCCTCSILHLCVIALDR
YWAITNAIEYARKRTAKRAALMILTVWTISIFISMPPLFWRSHRRLSPPPSQCTIQHDHV
IYTIYSTLGAFYIPLTLILILYYRIYHAAKSLYQKRGSSRHLSNRSTDSQNSFASCKLTQ
TFCVSDFSTSDPTTEFEKFHASIRIPPFDNDLDHPGERQQISSTRERKAARILGLILGAF
ILSWLPFFIKELIVGLSIYTVSSEVADFLTWLGYVNSLINPLLYTSFNEDFKLAFKKLIR
CREHT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50435344
n/a
NameBDBM50435344
Synonyms:CHEMBL2391541
TypeSmall organic molecule
Emp. Form.C17H22N2O
Mol. Mass.270.3694
SMILESCOc1ccc2[nH]cc(CCN(CC=C)CC=C)c2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: