Reaction Details |
| Report a problem with these data |
Target | 5-hydroxytryptamine receptor 1A |
---|
Ligand | BDBM21393 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1556024 (CHEMBL3767883) |
---|
Ki | 0.800000±n/a nM |
---|
Citation | Fiorino, F; Ciano, A; Magli, E; Severino, B; Corvino, A; Perissutti, E; Frecentese, F; Di Vaio, P; Izzo, AA; Capasso, R; Massarelli, P; Nencini, C; Rossi, I; Kedzierska, E; Orzelska-Gòrka, J; Bielenica, A; Santagada, V; Caliendo, G Synthesis, in vitro and in vivo pharmacological evaluation of serotoninergic ligands containing an isonicotinic nucleus. Eur J Med Chem110:133-50 (2016) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
5-hydroxytryptamine receptor 1A |
---|
Name: | 5-hydroxytryptamine receptor 1A |
Synonyms: | 5-HT-1A | 5-HT1 | 5-HT1A | 5-Hydroxytryptamine receptor 1A (5-HT1A) | 5-hydroxytryptamine receptor 1A (5HT1A) | 5HT1A_RAT | 5ht1a | G-21 | Htr1a | Serotonin 1 (5-HT1) receptor | Serotonin 1a (5-HT1a) receptor/Adrenergic receptor alpha-1 | Serotonin receptor 1A |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 46445.29 |
Organism: | Rattus norvegicus (rat) |
Description: | Binding assays were performed using rat hippocampal membranes. |
Residue: | 422 |
Sequence: | MDVFSFGQGNNTTASQEPFGTGGNVTSISDVTFSYQVITSLLLGTLIFCAVLGNACVVAA
IALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCC
TSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPED
RSDPDACTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVRKVEKKGAGT
SLGTSSAPPPKKSLNGQPGSGDWRRCAENRAVGTPCTNGAVRQGDDEATLEVIEVHRVGN
SKEHLPLPSESGSNSYAPACLERKNERNAEAKRKMALARERKTVKTLGIIMGTFILCWLP
FFIVALVLPFCESSCHMPALLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKIIKCKFC
RR
|
|
|
BDBM21393 |
---|
n/a |
---|
Name | BDBM21393 |
Synonyms: | 7-(dipropylamino)-5,6,7,8-tetrahydronaphthalen-1-ol | 8-Hydroxy-2-(di-n-propylamino)tetralin | 8-OH-DPAT | 8-OH-DPAT,(+) | 8-OH-DPAT,(-) | 8-hydroxy-N,N-dipropylaminotetralin | CHEMBL1788118 | CHEMBL505765 | CHEMBL56 | DPAT | US10562853, Compound 8-OH-DPAT | [3H]-8-OH-DPAT | cid_1220 |
Type | radiolabeled ligand |
Emp. Form. | C16H25NO |
Mol. Mass. | 247.3758 |
SMILES | CCCN(CCC)C1CCc2cccc(O)c2C1 |
Structure |
|