| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cereblon isoform 4 |
|---|
| Ligand | BDBM50070114 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1555519 (CHEMBL3768101) |
|---|
| Ki | 4400±n/a nM |
|---|
| Citation |  Boichenko, I; Deiss, S; Bär, K; Hartmann, MD; Hernandez Alvarez, B A FRET-Based Assay for the Identification and Characterization of Cereblon Ligands. J Med Chem59:770-4 (2016) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cereblon isoform 4 |
|---|
| Name: | Cereblon isoform 4 |
|---|
| Synonyms: | Cereblon isoform 4 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 13620.40 |
|---|
| Organism: | Magnetospirillum gryphiswaldense |
|---|
| Description: | ChEMBL_116733 |
|---|
| Residue: | 124 |
|---|
| Sequence: | MPLDAGGQNSTQMVLAPGASIFRCRQCGQTISRRDWLLPMGGDHEHVVFNPAGMIFRVWC
FSLAQGLRLIGAPSGEFSWFKGYDWTIALCGQCGSHLGWHYEGGSQPQTFFGLIKDRLAE
GPAD
|
|
|
|---|
| BDBM50070114 |
|---|
| n/a |
|---|
| Name | BDBM50070114 |
|---|
| Synonyms: | (+/-)-thalidomide | 2-(2,6-Dioxo-piperidin-3-yl)-isoindole-1,3-dione | 2-(2,6-dioxopiperidin-3-yl)isoindoline-1,3-dione | CHEMBL468 | K-17 | THALIDOMIDE | Thalomid | US11059801, Compound D-62 | [(R,S)-2-(2,6-dioxo-3-piperidinyl)-1H-isoindole-1,3(2H)-dione |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C13H10N2O4 |
|---|
| Mol. Mass. | 258.2295 |
|---|
| SMILES | O=C1N(C2CCC(=O)NC2=O)C(=O)c2ccccc12 |
|---|
| Structure | 
|
|---|
Search and Browse
