Reaction Details |
| Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50151270 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1559078 (CHEMBL3773934) |
---|
Ki | 20±n/a nM |
---|
Citation | Franchini, S; Battisti, UM; Prandi, A; Tait, A; Borsari, C; Cichero, E; Fossa, P; Cilia, A; Prezzavento, O; Ronsisvalle, S; Aricò, G; Parenti, C; Brasili, L Scouting new sigma receptor ligands: Synthesis, pharmacological evaluation and molecular modeling of 1,3-dioxolane-based structures and derivatives. Eur J Med Chem112:1-19 (2016) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | OPRS1 | SGMR1_CAVPO | SIGMAR1 | Sigma 1-type opioid receptor | Sigma non-opioid intracellular receptor 1 | Sigma-1 receptor | Sigma1-receptor | Sigma1R | Sterol isomerase-like protein |
Type: | Protein |
Mol. Mass.: | 25307.17 |
Organism: | Cavia porcellus (Guinea pig) |
Description: | Q60492 |
Residue: | 223 |
Sequence: | MQWAVGRRWLWVALFLAAVAVLTQIVWLWLGTQNFVFQREEIAQLARQYAGLDHELAFSK
LIVELRRLHPVHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSPRHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLGFALADTVFSTQDFLTLFYTLRVYARALQLELTTYLFGQDP
|
|
|
BDBM50151270 |
---|
n/a |
---|
Name | BDBM50151270 |
Synonyms: | CHEMBL3769825 |
Type | Small organic molecule |
Emp. Form. | C26H30N2O |
Mol. Mass. | 386.5292 |
SMILES | C(CN1CCN(Cc2ccccc2)CC1)OC(c1ccccc1)c1ccccc1 |
Structure |
|