| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cyclin-dependent kinase 4 |
|---|
| Ligand | BDBM6309 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1561546 (CHEMBL3776183) |
|---|
| IC50 | 16±n/a nM |
|---|
| Citation |  Vymetalová, L; Havlícek, L; ?turc, A; Skrá?ková, Z; Jorda, R; Pospí?il, T; Strnad, M; Kry?tof, V 5-Substituted 3-isopropyl-7-[4-(2-pyridyl)benzyl]amino-1(2)H-pyrazolo[4,3-d]pyrimidines with anti-proliferative activity as potent and selective inhibitors of cyclin-dependent kinases. Eur J Med Chem110:291-301 (2016) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cyclin-dependent kinase 4 |
|---|
| Name: | Cyclin-dependent kinase 4 |
|---|
| Synonyms: | CDK4 | CDK4_HUMAN | Cell division protein kinase 4 | Cyclin-dependent kinase 4 (CDK 4) | PSK-J3 |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 33731.96 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P11802 |
|---|
| Residue: | 303 |
|---|
| Sequence: | MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALL
RRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDL
MRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWY
RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR
DVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEG
NPE
|
|
|
|---|
| BDBM6309 |
|---|
| n/a |
|---|
| Name | BDBM6309 |
|---|
| Synonyms: | 6-Acetyl-8-cyclopentyl-5-methyl-2-(5-piperazin-1-yl-pyridin-2-ylamino)-8H-pyrido[2,3-d]pyrimidin-7-one Hydrochloride | 8-cyclopentyl-6-acetyl-5-methyl-2-{[5-(piperazin-1-yl)pyridin-2-yl]amino}-7H,8H-pyrido[2,3-d]pyrimidin-7-one | Ibrance | PD 0332991 | Palbociclib | Pyrido-[2,3-d]-pyrimidin-7-one 43 | US10189849, PD0332991 | US10464927, Compound Palbociclib | US10626107, Example Palbociclib | US10696682, Compound PD0332991 | US10927120, PD0332991 | US9464092, PD0332991 | US9957276, PD0332991 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H29N7O2 |
|---|
| Mol. Mass. | 447.5328 |
|---|
| SMILES | CC(=O)c1c(C)c2cnc(Nc3ccc(cn3)N3CCNCC3)nc2n(C2CCCC2)c1=O |
|---|
| Structure | 
|
|---|
Search and Browse
