Reaction Details |
| Report a problem with these data |
Target | G-protein coupled bile acid receptor 1 |
---|
Ligand | BDBM19190 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1572018 (CHEMBL3796546) |
---|
IC50 | 251±n/a nM |
---|
Citation | Agarwal, S; Patil, A; Aware, U; Deshmukh, P; Darji, B; Sasane, S; Sairam, KV; Priyadarsiny, P; Giri, P; Patel, H; Giri, S; Jain, M; Desai, RC Discovery of a Potent and Orally Efficacious TGR5 Receptor Agonist. ACS Med Chem Lett7:51-5 (2016) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
G-protein coupled bile acid receptor 1 |
---|
Name: | G-protein coupled bile acid receptor 1 |
Synonyms: | BG37 | GPBAR1 | GPBAR_HUMAN | M-BAR | TGR5 | hBG37 | hGPCR19 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 35260.02 |
Organism: | Homo sapiens (Human) |
Description: | CHO cells transiently transfected with hTGR5. |
Residue: | 330 |
Sequence: | MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLA
GLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQP
PGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGA
AAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPY
VATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQ
GLWGRASRDSPGPSIAYHPSSQSSVDLDLN
|
|
|
BDBM19190 |
---|
n/a |
---|
Name | BDBM19190 |
Synonyms: | (1S,2R,10S,11S,14R,15S,17S)-14,17-dihydroxy-14-(2-hydroxyacetyl)-2,15-dimethyltetracyclo[8.7.0.0^{2,7}.0^{11,15}]heptadeca-3,6-dien-5-one | CHEMBL131 | Delta-Cortef | Deltacortril | Prednisolone | US10196374, Prednisolone |
Type | Steroid |
Emp. Form. | C21H28O5 |
Mol. Mass. | 360.444 |
SMILES | [H][C@@]12CC[C@](O)(C(=O)CO)[C@@]1(C)C[C@H](O)[C@@]1([H])[C@@]2([H])CCC2=CC(=O)C=C[C@]12C |r,c:27,t:23| |
Structure |
|