Reaction Details |
| Report a problem with these data |
Target | G-protein coupled bile acid receptor 1 |
---|
Ligand | BDBM50161836 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1572016 (CHEMBL3796544) |
---|
EC50 | 2.3±n/a nM |
---|
Citation | Agarwal, S; Patil, A; Aware, U; Deshmukh, P; Darji, B; Sasane, S; Sairam, KV; Priyadarsiny, P; Giri, P; Patel, H; Giri, S; Jain, M; Desai, RC Discovery of a Potent and Orally Efficacious TGR5 Receptor Agonist. ACS Med Chem Lett7:51-5 (2016) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
G-protein coupled bile acid receptor 1 |
---|
Name: | G-protein coupled bile acid receptor 1 |
Synonyms: | BG37 | GPBAR1 | GPBAR_HUMAN | M-BAR | TGR5 | hBG37 | hGPCR19 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 35260.02 |
Organism: | Homo sapiens (Human) |
Description: | CHO cells transiently transfected with hTGR5. |
Residue: | 330 |
Sequence: | MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLA
GLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQP
PGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGA
AAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPY
VATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQ
GLWGRASRDSPGPSIAYHPSSQSSVDLDLN
|
|
|
BDBM50161836 |
---|
n/a |
---|
Name | BDBM50161836 |
Synonyms: | CHEMBL3793012 |
Type | Small organic molecule |
Emp. Form. | C29H28FN3O3S |
Mol. Mass. | 517.614 |
SMILES | COc1ccc(cc1OC)C(C)(C)c1cnc(SCCOc2ccc(cc2)C#N)n1-c1ccc(F)cc1 |
Structure |
|