Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDopamine receptors; D2 & D4
LigandBDBM50156966
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1571915
Ki 10±n/a nM
Citation Witt JOMcCollum ALHurtado MAHuseman EDJeffries DETemple KJPlumley HCBlobaum ALLindsley CWHopkins CR Synthesis and characterization of a series of chiral alkoxymethyl morpholine analogs as dopamine receptor 4 (D4R) antagonists. Bioorg Med Chem Lett 26:2481-8 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Dopamine receptors; D2 & D4
Name:D2-like dopamine receptor
Synonyms:D(2C) dopamine receptor | D(4) dopamine receptor | DOPAMINE D4 | DOPAMINE D4.2 | DOPAMINE D4.4 | DRD4 | Dopamine D4 receptor
Type:Enzyme
Mol. Mass.:48373.19
Organism:Homo sapiens (Human)
Description:P21917
Residue:467
Sequence:
MGNRSTADADGLLAGRGPAAGASAGASAGLAGQGAAALVGGVLLIGAVLAGNSLVCVSVA
TERALQTPTNSFIVSLAAADLLLALLVLPLFVYSEVQGGAWLLSPRLCDALMAMDVMLCT
ASIFNLCAISVDRFVAVAVPLRYNRQGGSRRQLLLIGATWLLSAAVAAPVLCGLNDVRGR
DPAVCRLEDRDYVVYSSVCSFFLPCPLMLLLYWATFRGLQRWEVARRAKLHGRAPRRPSG
PGPPSPTPPAPRLPQDPCGPDCAPPAPGLPRGPCGPDCAPAAPGLPPDPCGPDCAPPAPG
LPQDPCGPDCAPPAPGLPRGPCGPDCAPPAPGLPQDPCGPDCAPPAPGLPPDPCGSNCAP
PDAVRAAALPPQTPPQTRRRRRAKITGRERKAMRVLPVVVGAFLLCWTPFFVVHITQALC
PACSVPPRLVSAVTWLGYVNSALNPVIYTVFNAEFRNVFRKALRACC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50156966
n/a
NameBDBM50156966
Synonyms:CHEMBL3792803
TypeSmall organic molecule
Emp. Form.C19H21ClFNO3
Mol. Mass.365.826
SMILESCOc1cc(CN2CCO[C@H](COc3cccc(F)c3)C2)ccc1Cl |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: