| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Free fatty acid receptor 1 |
|---|
| Ligand | BDBM50157618 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1568678 (CHEMBL3791346) |
|---|
| EC50 | 20±n/a nM |
|---|
| Citation |  Hansen, SV; Christiansen, E; Urban, C; Hudson, BD; Stocker, CJ; Due-Hansen, ME; Wargent, ET; Shimpukade, B; Almeida, R; Ejsing, CS; Cawthorne, MA; Kassack, MU; Milligan, G; Ulven, T Discovery of a Potent Free Fatty Acid 1 Receptor Agonist with Low Lipophilicity, Low Polar Surface Area, and Robust in Vivo Efficacy. J Med Chem59:2841-6 (2016) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Free fatty acid receptor 1 |
|---|
| Name: | Free fatty acid receptor 1 |
|---|
| Synonyms: | FFAR1 | FFAR1_HUMAN | G-protein Coupled Receptor 40 | GPR40 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 31473.32 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | O14842 |
|---|
| Residue: | 300 |
|---|
| Sequence: | MDLPPQLSFGLYVAAFALGFPLNVLAIRGATAHARLRLTPSLVYALNLGCSDLLLTVSLP
LKAVEALASGAWPLPASLCPVFAVAHFFPLYAGGGFLAALSAGRYLGAAFPLGYQAFRRP
CYSWGVCAAIWALVLCHLGLVFGLEAPGGWLDHSNTSLGINTPVNGSPVCLEAWDPASAG
PARFSLSLLLFFLPLAITAFCYVGCLRALARSGLTHRRKLRAAWVAGGALLTLLLCVGPY
NASNVASFLYPNLGGSWRKLGLITGAWSVVLNPLVTGYLGRGPGLKTVCAARTQGGKSQK
|
|
|
|---|
| BDBM50157618 |
|---|
| n/a |
|---|
| Name | BDBM50157618 |
|---|
| Synonyms: | CHEMBL3785637 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C15H15FO2 |
|---|
| Mol. Mass. | 246.2768 |
|---|
| SMILES | C\C=C(\C)C#Cc1ccc(CCC(O)=O)c(F)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
