| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Carbonic anhydrase |
|---|
| Ligand | BDBM50158514 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1566139 (CHEMBL3787808) |
|---|
| Ki | 22±n/a nM |
|---|
| Citation |  Akdemir, A; Güzel-Akdemir, Ö; Karali, N; Supuran, CT Isatin analogs as novel inhibitors of Candida spp.ß-carbonic anhydrase enzymes. Bioorg Med Chem24:1648-52 (2016) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Carbonic anhydrase |
|---|
| Name: | Carbonic anhydrase |
|---|
| Synonyms: | n/a |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 24709.64 |
|---|
| Organism: | Candida glabrata |
|---|
| Description: | ChEMBL_584597 |
|---|
| Residue: | 219 |
|---|
| Sequence: | MTKDTIFTLTGKCALDNILDANRQWAQAMHRSQPQLFPTNGQGQDPHTLFIGCSDSRYNE
DCLGVLPGEIFTLKTVANICHTDDHSLLATLEFAILNLKVNRIILCGHTDCGGIKTCLLG
RESIKESCPHLYEHLDDIEDLVESHESELNQLDNICSKSKLMSHRNVERQLQRLLQIPVV
QDALRNSNQDHEFNIFGLVYNVDSGLVDVVREVYGNQQK
|
|
|
|---|
| BDBM50158514 |
|---|
| n/a |
|---|
| Name | BDBM50158514 |
|---|
| Synonyms: | CHEMBL3786724 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C14H10FN3O3S |
|---|
| Mol. Mass. | 319.311 |
|---|
| SMILES | NS(=O)(=O)c1ccc(cc1)\N=C1/C(=O)Nc2ccc(F)cc12 |
|---|
| Structure | 
|
|---|
Search and Browse
