Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAurora kinase B
LigandBDBM50166588
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1576575
IC50>1000±n/a nM
Citation Katoh TTakai TYukawa TTsukamoto TWatanabe EMototani HArita THayashi HNakagawa HKlein MGZou HSang BCSnell GNakada Y Discovery and optimization of 1,7-disubstituted-2,2-dimethyl-2,3-dihydroquinazolin-4(1H)-ones as potent and selective PKC┐ inhibitors. Bioorg Med Chem 24:2466-75 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Aurora kinase B
Name:Aurora kinase B
Synonyms:AIM-1 | Aurora B kinase (aurB) | Aurora B-INCENP | Aurora kinase 2 | Aurora kinase B (AURKB) | Aurora-related kinase 2 | STK-1 | Serine/threonine-protein kinase aurora B
Type:Protein
Mol. Mass.:39327.72
Organism:Homo sapiens (Human)
Description:Q96GD4
Residue:344
Sequence:
MAQKENSYPWPYGRQTAPSGLSTLPQRVLRKEPVTPSALVLMSRSNVQPTAAPGQKVMEN
SSGTPDILTRHFTIDDFEIGRPLGKGKFGNVYLAREKKSHFIVALKVLFKSQIEKEGVEH
QLRREIEIQAHLHHPNILRLYNYFYDRRRIYLILEYAPRGELYKELQKSCTFDEQRTATI
MEELADALMYCHGKKVIHRDIKPENLLLGLKGELKIADFGWSVHAPSLRRKTMCGTLDYL
PPEMIEGRMHNEKVDLWCIGVLCYELLVGNPPFESASHNETYRRIVKVDLKFPASVPMGA
QDLISKLLRHNPSERLPLAQVSAHPWVRANSRRVLPPSALQSVA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50166588
n/a
NameBDBM50166588
Synonyms:CHEMBL3798011
TypeSmall organic molecule
Emp. Form.C24H23N5O2
Mol. Mass.413.4717
SMILESC[C@@H](N1c2cc(ccc2C(=O)NC1(C)C)-n1c2cccnc2[nH]c1=O)c1ccccc1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: