Reaction Details |
| Report a problem with these data |
Target | 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase |
---|
Ligand | BDBM50181516 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_1585632 |
---|
Kd | 68000±n/a nM |
---|
Citation | Dennis, ML; Pitcher, NP; Lee, MD; DeBono, AJ; Wang, ZC; Harjani, JR; Rahmani, R; Cleary, B; Peat, TS; Baell, JB; Swarbrick, JD Structural Basis for the Selective Binding of Inhibitors to 6-Hydroxymethyl-7,8-dihydropterin Pyrophosphokinase from Staphylococcus aureus and Escherichia coli. J Med Chem59:5248-63 (2016) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase |
---|
Name: | 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase |
Synonyms: | 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase | 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase | 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase | HPPK | HPPK_ECOLI | JW0138 | PPPK | folK |
Type: | PROTEIN |
Mol. Mass.: | 18075.55 |
Organism: | Escherichia coli (strain K12) |
Description: | ChEMBL_108237 |
Residue: | 159 |
Sequence: | MTVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPDYLNAAVA
LETSLAPEELLNHTQRIELQQGRVRKAERWGPRTLDLDIMLFGNEVINTERLTVPHYDMK
NRGFMLWPLFEIAPELVFPDGEMLRQILHTRAFDKLNKW
|
|
|
BDBM50181516 |
---|
n/a |
---|
Name | BDBM50181516 |
Synonyms: | CHEMBL3819390 |
Type | Small organic molecule |
Emp. Form. | C8H11N5O2S |
Mol. Mass. | 241.27 |
SMILES | Nc1nc2[nH]c(SCCCO)nc2c(=O)[nH]1 |
Structure |
|