| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma non-opioid intracellular receptor 1 |
|---|
| Ligand | BDBM50108653 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_1591351 |
|---|
| Ki | 1.3±n/a nM |
|---|
| Citation |  Knappmann, I; Schepmann, D; Wünsch, B Oxa-Pictet-Spengler reaction as key step in the synthesis of novels receptor ligands with 2-benzopyran structure. Bioorg Med Chem24:4045-4055 (2016) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma non-opioid intracellular receptor 1 |
|---|
| Name: | Sigma non-opioid intracellular receptor 1 |
|---|
| Synonyms: | OPRS1 | SGMR1_CAVPO | SIGMAR1 | Sigma 1-type opioid receptor | Sigma non-opioid intracellular receptor 1 | Sigma-1 receptor | Sigma1-receptor | Sigma1R | Sterol isomerase-like protein |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 25307.17 |
|---|
| Organism: | Cavia porcellus (Guinea pig) |
|---|
| Description: | Q60492 |
|---|
| Residue: | 223 |
|---|
| Sequence: | MQWAVGRRWLWVALFLAAVAVLTQIVWLWLGTQNFVFQREEIAQLARQYAGLDHELAFSK
LIVELRRLHPVHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSPRHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLGFALADTVFSTQDFLTLFYTLRVYARALQLELTTYLFGQDP
|
|
|
|---|
| BDBM50108653 |
|---|
| n/a |
|---|
| Name | BDBM50108653 |
|---|
| Synonyms: | 1'-benzyl-3-methoxyspiro[3,4-dihydro-1H-isochromene-1,4'-(hexahydropyridine)] | 1'-benzyl-3-methoxyspiro[isochroman-1,4'-piperidine] | CHEMBL141209 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H25NO2 |
|---|
| Mol. Mass. | 323.4287 |
|---|
| SMILES | COC1Cc2ccccc2C2(CCN(Cc3ccccc3)CC2)O1 |
|---|
| Structure | 
|
|---|
Search and Browse
