Reaction Details |
| Report a problem with these data |
Target | Chromobox protein homolog 7 |
---|
Ligand | BDBM50194260 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1616628 (CHEMBL3858697) |
---|
IC50 | 230±n/a nM |
---|
Citation | Stuckey, JI; Simpson, C; Norris-Drouin, JL; Cholensky, SH; Lee, J; Pasca, R; Cheng, N; Dickson, BM; Pearce, KH; Frye, SV; James, LI Structure-Activity Relationships and Kinetic Studies of Peptidic Antagonists of CBX Chromodomains. J Med Chem59:8913-8923 (2016) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Chromobox protein homolog 7 |
---|
Name: | Chromobox protein homolog 7 |
Synonyms: | CBX7 | CBX7_HUMAN | Chromobox protein homolog 7 | Chromobox protein homolog 7 (CBX7) |
Type: | Protein |
Mol. Mass.: | 28351.76 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 251 |
Sequence: | MELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEK
EERDRASGYRKRGPKPKRLLLQRLYSMDLRSSHKAKGKEKLCFSLTCPLGSGSPEGVVKA
GAPELVDKGPLVPTLPFPLRKPRKAHKYLRLSRKKFPPRGPNLESHSHRRELFLQEPPAP
DVLQAAGEWEPAAQPPEEEADADLAEGPPPWTPALPSSEVTVTDITANSITVTFREAQAA
EGFFRDRSGKF
|
|
|
BDBM50194260 |
---|
n/a |
---|
Name | BDBM50194260 |
Synonyms: | CHEMBL3973366 |
Type | Small organic molecule |
Emp. Form. | C40H57F3N6O8 |
Mol. Mass. | 806.9112 |
SMILES | CCN(CC)CCCC[C@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](C)NC(=O)[C@H](Cc1ccccc1)NC(=O)c1ccc(cc1)C(F)(F)F)C(=O)N[C@@H](CO)C(=O)OC |r| |
Structure |
|