| Reaction Details |
|---|
 | Report a problem with these data |
| Target | CDGSH iron-sulfur domain-containing protein 1 |
|---|
| Ligand | BDBM50340098 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1620948 (CHEMBL3863231) |
|---|
| Ki | 74±n/a nM |
|---|
| Citation |  Geldenhuys, WJ; Yonutas, HM; Morris, DL; Sullivan, PG; Darvesh, AS; Leeper, TC Identification of small molecules that bind to the mitochondrial protein mitoNEET. Bioorg Med Chem Lett26:5350-5353 (2016) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| CDGSH iron-sulfur domain-containing protein 1 |
|---|
| Name: | CDGSH iron-sulfur domain-containing protein 1 |
|---|
| Synonyms: | C10orf70 | CISD1 | CISD1_HUMAN | MitoNEET | ZCD1 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 12206.48 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_766432 |
|---|
| Residue: | 108 |
|---|
| Sequence: | MSLTSSSSVRVEWIAAVTIAAGTAAIGYLAYKRFYVKDHRNKAMINLHIQKDNPKIVHAF
DMEDLGDKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKKET
|
|
|
|---|
| BDBM50340098 |
|---|
| n/a |
|---|
| Name | BDBM50340098 |
|---|
| Synonyms: | 5-(4-hydroxy-3-methoxybenzylidene)-2-thioxothiazolidin-4-one | CHEMBL255822 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C11H9NO3S2 |
|---|
| Mol. Mass. | 267.324 |
|---|
| SMILES | COc1cc(C=C2SC(S)=NC2=O)ccc1O |w:5.4,c:9| |
|---|
| Structure | 
|
|---|
Search and Browse
