| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Peptidyl-prolyl cis-trans isomerase A |
|---|
| Ligand | BDBM50198901 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1620950 (CHEMBL3863233) |
|---|
| Kd | >600000±n/a nM |
|---|
| Citation |  Granger, BA; Brown, DG Design and synthesis of peptide-based macrocyclic cyclophilin inhibitors. Bioorg Med Chem Lett26:5304-5307 (2016) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Peptidyl-prolyl cis-trans isomerase A |
|---|
| Name: | Peptidyl-prolyl cis-trans isomerase A |
|---|
| Synonyms: | CYPA | CYPA PPIase | Cyclophilin A | Cyclosporin A-binding protein | PPIA | PPIA_HUMAN | PPIase A | Peptidyl-prolyl cis-trans isomerase A | Rotamase A |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 18015.32 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P62937 |
|---|
| Residue: | 165 |
|---|
| Sequence: | MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGF
MCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTE
WLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE
|
|
|
|---|
| BDBM50198901 |
|---|
| n/a |
|---|
| Name | BDBM50198901 |
|---|
| Synonyms: | CHEMBL3982549 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H37ClN4O7 |
|---|
| Mol. Mass. | 541.037 |
|---|
| SMILES | Cl.C[C@]1(COCCCCOC[C@H](NC(=O)[C@@H]2CCCN2C(=O)CNC1=O)C(O)=O)NCc1ccccc1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
