Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdrenergic alpha1B
LigandBDBM50201789
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1625179
Ki 14±n/a nM
Citation Silva ROde Oliveira ASNunes Lemes LFde Camargo Nascente LCoelho do Nascimento Nogueira PSilveira ERBrand GDVistoli GCilia APoggesi EBuccioni MMarucci GBolognesi MLRomeiro LAS Synthesis and structure-activity relationships of novel arylpiperazines as potent antagonists ofa1-adrenoceptor. Eur J Med Chem 122:601-610 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adrenergic alpha1B
Name:Adrenergic receptor alpha
Synonyms:Alpha 1B-adrenoceptor | Alpha 1B-adrenoreceptor | Alpha-1B adrenergic receptor
Type:Enzyme
Mol. Mass.:56862.13
Organism:Homo sapiens (Human)
Description:P35368
Residue:520
Sequence:
MNPDLDTGHNTSAPAHWGELKNANFTGPNQTSSNSTLPQLDITRAISVGLVLGAFILFAI
VGNILVILSVACNRHLRTPTNYFIVNLAMADLLLSFTVLPFSAALEVLGYWVLGRIFCDI
WAAVDVLCCTASILSLCAISIDRYIGVRYSLQYPTLVTRRKAILALLSVWVLSTVISIGP
LLGWKEPAPNDDKECGVTEEPFYALFSSLGSFYIPLAVILVMYCRVYIVAKRTTKNLEAG
VMKEMSNSKELTLRIHSKNFHEDTLSSTKAKGHNPRSSIAVKLFKFSREKKAAKTLGIVV
GMFILCWLPFFIALPLGSLFSTLKPPDAVFKVVFWLGYFNSCLNPIIYPCSSKEFKRAFV
RILGCQCRGRGRRRRRRRRRLGGCAYTYRPWTRGGSLERSQSRKDSLDDSGSCLSGSQRT
LPSASPSPGYLGRGAPPPVELCAFPEWKAPGALLSLPAPEPPGRRGRHDSGPLFTFKLLT
EPESPGTDGGASNGGCEAAADVANGQPGFKSNMPLAPGQF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50201789
n/a
NameBDBM50201789
Synonyms:CHEMBL3946843
TypeSmall organic molecule
Emp. Form.C22H30N2O2
Mol. Mass.354.4858
SMILESCOc1cccc(CCN2CCN(CC2)c2ccccc2OC(C)C)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: