| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Free fatty acid receptor 4 |
|---|
| Ligand | BDBM50207070 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1629515 (CHEMBL3872141) |
|---|
| EC50 | 220±n/a nM |
|---|
| Citation |  Adams, GL; Velazquez, F; Jayne, C; Shah, U; Miao, S; Ashley, ER; Madeira, M; Akiyama, TE; Di Salvo, J; Suzuki, T; Wang, N; Truong, Q; Gilbert, E; Zhou, D; Verras, A; Kirkland, M; Pachanski, M; Powles, M; Yin, W; Ujjainwalla, F; Venkatraman, S; Edmondson, SD Discovery of Chromane Propionic Acid Analogues as Selective Agonists of GPR120 with ACS Med Chem Lett8:96-101 (2017) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Free fatty acid receptor 4 |
|---|
| Name: | Free fatty acid receptor 4 |
|---|
| Synonyms: | FFAR4 | FFAR4_HUMAN | G-protein coupled receptor 120 | G-protein coupled receptor 129 | G-protein coupled receptor GT01 | G-protein coupled receptor PGR4 | GPR120 | GPR129 | O3FAR1 | Omega-3 fatty acid receptor 1 | PGR4 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 42256.91 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_1508994 |
|---|
| Residue: | 377 |
|---|
| Sequence: | MSPECARAAGDAPLRSLEQANRTRFPFFSDVKGDHRLVLAAVETTVLVLIFAVSLLGNVC
ALVLVARRRRRGATACLVLNLFCADLLFISAIPLVLAVRWTEAWLLGPVACHLLFYVMTL
SGSVTILTLAAVSLERMVCIVHLQRGVRGPGRRARAVLLALIWGYSAVAALPLCVFFRVV
PQRLPGADQEISICTLIWPTIPGEISWDVSFVTLNFLVPGLVIVISYSKILQTSEHLLDA
RAVVTHSEITKASRKRLTVSLAYSESHQIRVSQQDFRLFRTLFLLMVSFFIMWSPIIITI
LLILIQNFKQDLVIWPSLFFWVVAFTFANSALNPILYNMTLCRNEWKKIFCCFWFPEKGA
ILTDTSVKRNDLSIISG
|
|
|
|---|
| BDBM50207070 |
|---|
| n/a |
|---|
| Name | BDBM50207070 |
|---|
| Synonyms: | CHEMBL3986721 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H23FN4O2 |
|---|
| Mol. Mass. | 394.442 |
|---|
| SMILES | Fc1ccc(OC2CCC2)cc1-c1ccc2O[C@@H](CCc3nnn[nH]3)CCc2c1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
