Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCannabinoid receptor 2
LigandBDBM106773
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1630568
Ki 700±n/a nM
Citation Romero-Parra JMella-Raipán JPalmieri VAllarà MTorres MJPessoa-Mahana HIturriaga-Vásquez PEscobar RFaúndez MDi Marzo VPessoa-Mahana CD Synthesis, binding assays, cytotoxic activity and docking studies of benzimidazole and benzothiophene derivatives with selective affinity for the CB2 cannabinoid receptor. Eur J Med Chem 124:17-35 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cannabinoid receptor 2
Name:Cannabinoid receptor 2
Synonyms:CANNABINOID CB2 | CB-2 | CB2 | CB2A | CB2B | CNR2 | CX5 | Cannabinoid CB2 receptor | Cannabinoid receptor 2 (CB2) | Cannabinoid receptor 2 (CB2R) | hCB2
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:39690.94
Organism:Homo sapiens (Human)
Description:P34972
Residue:360
Sequence:
MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILS
SHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTAS
VGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCS
ELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLD
VRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYA
LRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM106773
n/a
NameBDBM106773
Synonyms:2‐(4‐methoxyphenyl)‐1‐[(4‐methoxyphenyl)methyl]‐ 1,3‐benzodiazole (B14)
TypeSmall organic molecule
Emp. Form.C22H20N2O2
Mol. Mass.344.4064
SMILESCOc1ccc(Cn2c(nc3ccccc23)-c2ccc(OC)cc2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: