Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPancreatic lipase
LigandBDBM50207381
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1631106
Ki 19600±n/a nM
Citation Sridhar SNGinson GVenkataramana Reddy POTantak MPKumar DPaul AT Synthesis, evaluation and molecular modelling studies of 2-(carbazol-3-yl)-2-oxoacetamide analogues as a new class of potential pancreatic lipase inhibitors. Bioorg Med Chem 25:609-620 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Pancreatic lipase
Name:Pancreatic triacylglycerol lipase
Synonyms:PL | PTL | Pancreatic triacylglycerol lipase
Type:Enzyme
Mol. Mass.:50080.69
Organism:Sus scrofa (Pig)
Description:P00591
Residue:450
Sequence:
SEVCFPRLGCFSDDAPWAGIVQRPLKILPWSPKDVDTRFLLYTNQNQNNYQELVADPSTI
TNSNFRMDRKTRFIIHGFIDKGEEDWLSNICKNLFKVESVNCICVDWKGGSRTGYTQASQ
NIRIVGAEVAYFVEVLKSSLGYSPSNVHVIGHSLGSHAAGEAGRRTNGTIERITGLDPAE
PCFQGTPELVRLDPSDAKFVDVIHTDAAPIIPNLGFGMSQTVGHLDFFPNGGKQMPGCQK
NILSQIVDIDGIWEGTRDFVACNHLRSYKYYADSILNPDGFAGFPCDSYNVFTANKCFPC
PSEGCPQMGHYADRFPGKTNGVSQVFYLNTGDASNFARWRYKVSVTLSGKKVTGHILVSL
FGNEGNSRQYEIYKGTLQPDNTHSDEFDSDVEVGDLQKVKFIWYNNNVINPTLPRVGASK
ITVERNDGKVYDFCSQETVREEVLLTLNPC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50207381
n/a
NameBDBM50207381
Synonyms:CHEMBL3934940
TypeSmall organic molecule
Emp. Form.C30H25ClN2O5
Mol. Mass.528.983
SMILESCOc1cc(NC(=O)C(=O)c2ccc3n(Cc4ccc(Cl)cc4)c4ccccc4c3c2)cc(OC)c1OC
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: