Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDual specificty protein kinase CLK1
LigandBDBM50208709
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1633065
IC50 51±n/a nM
Citation Labrière CLozach OBlairvacq MMeijer LGuillou C Further investigation of Paprotrain: Towards the conception of selective and multi-targeted CNS kinase inhibitors. Eur J Med Chem 124:920-934 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Dual specificty protein kinase CLK1
Name:Dual specificity protein kinase CLK1/CLK4
Synonyms:CDC-like kinase 1 | CDC-like kinase 1 (CLK1) | CDC2-like kinase 1 (CLK1) | Dual specificity protein kinase CLK1
Type:Protein
Mol. Mass.:57322.21
Organism:Homo sapiens (Human)
Description:P49759
Residue:484
Sequence:
MRHSKRTYCPDWDDKDWDYGKWRSSSSHKRRKRSHSSAQENKRCKYNHSKMCDSHYLESR
SINEKDYHSRRYIDEYRNDYTQGCEPGHRQRDHESRYQNHSSKSSGRSGRSSYKSKHRIH
HSTSHRRSHGKSHRRKRTRSVEDDEEGHLICQSGDVLSARYEIVDTLGEGAFGKVVECID
HKAGGRHVAVKIVKNVDRYCEAARSEIQVLEHLNTTDPNSTFRCVQMLEWFEHHGHICIV
FELLGLSTYDFIKENGFLPFRLDHIRKMAYQICKSVNFLHSNKLTHTDLKPENILFVQSD
YTEAYNPKIKRDERTLINPDIKVVDFGSATYDDEHHSTLVSTRHYRAPEVILALGWSQPC
DVWSIGCILIEYYLGFTVFPTHDSKEHLAMMERILGPLPKHMIQKTRKRKYFHHDRLDWD
EHSSAGRYVSRRCKPLKEFMLSQDVEHERLFDLIQKMLEYDPAKRITLREALKHPFFDLL
KKSI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50208709
n/a
NameBDBM50208709
Synonyms:CHEMBL3883639
TypeSmall organic molecule
Emp. Form.C17H11N3O
Mol. Mass.273.2887
SMILESCOc1ccc2[nH]c3c(c(cc4cnccc34)C#N)c2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: