Reaction Details |
| Report a problem with these data |
Target | Translocator protein |
---|
Ligand | BDBM50210858 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1635026 (CHEMBL3877924) |
---|
Ki | 0.300000±n/a nM |
---|
Citation | Cacheux, F; Médran-Navarrete, V; Dollé, F; Marguet, F; Puech, F; Damont, A Synthesis and in vitro characterization of novel fluorinated derivatives of the translocator protein 18 kDa ligand CfO-DPA-714. Eur J Med Chem125:346-359 (2017) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Translocator protein |
---|
Name: | Translocator protein |
Synonyms: | Benzodiazepine receptors; peripheral & central | Bzrp | Mbr | Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor (PBR) | Peripheral-Type Benzodiazepine Receptor | TSPO_RAT | Tspo |
Type: | Mitochondrion membrane protein |
Mol. Mass.: | 18945.84 |
Organism: | Rattus norvegicus (rat) |
Description: | Competitive binding experiments were performed on rat kidney mitochondrial membranes. |
Residue: | 169 |
Sequence: | MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAM
GYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVAT
ATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE
|
|
|
BDBM50210858 |
---|
n/a |
---|
Name | BDBM50210858 |
Synonyms: | CHEMBL3906952 |
Type | Small organic molecule |
Emp. Form. | C27H29FN4O |
Mol. Mass. | 444.5438 |
SMILES | CN(Cc1ccccc1)C(=O)Cc1c(nn2c(C)cc(C)nc12)-c1ccc(CCCF)cc1 |
Structure |
|