new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerotonin 1d (5-HT1d) receptor
LigandBDBM50060426
Substrate/Competitorn/a
Meas. Tech.ChEBML_1955
IC50 0.430000±n/a nM
Citation  TBA Bioorg Med Chem Lett 6:1825-1830 (1996)  
More Info.:Get all data from this article,  Assay Method
 
Serotonin 1d (5-HT1d) receptor
Name:Serotonin 1d (5-HT1d) receptor
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:32680.56
Organism:Sus scrofa
Description:ChEMBL_1963
Residue:291
Sequence:
AMTDLLVSILVMPISIPYTITQTWSFGQLLCDIWLSSDITCCTASILHLCVIALDRYWAI
TDALEYSKRRTAGHAAAMIAIVWAISICISIPPLFWRQARAHEEISDCLVNTSQISYTIY
STCGAFYIPSLLLIILYGRIYRAARNRILNPPSLYGKRFTTAHLITGSAGSSLCSLNPSL
HEGHSHSAGSPLFFNHVKIKLADSVLERKRISAARERKATKTLGIILGAFIICWLPFFVA
SLVLPICRDSCWIHPALFDFFTWLGYLNSLINPIIYTVFNEEFRQAFQKVV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50060426
n/a
NameBDBM50060426
Synonyms:CHEMBL296161 | Dimethyl-[2-(5-[1,2,4]triazol-4-yl-1H-indol-3-yl)-ethyl]-amine | L-741604
TypeSmall organic molecule
Emp. Form.C14H17N5
Mol. Mass.255.3183
SMILESCN(C)CCc1c[nH]c2ccc(cc12)-n1cnnc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: