new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerotonin 1d (5-HT1d) receptor
LigandBDBM50213961
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1955
IC50 8±n/a nM
Citation  TBA Bioorg Med Chem Lett 6:1825-1830 (1996)  
More Info.:Get all data from this article,  Assay Method
 
Serotonin 1d (5-HT1d) receptor
Name:Serotonin 1d (5-HT1d) receptor
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:32680.56
Organism:Sus scrofa
Description:ChEMBL_1963
Residue:291
Sequence:
AMTDLLVSILVMPISIPYTITQTWSFGQLLCDIWLSSDITCCTASILHLCVIALDRYWAI
TDALEYSKRRTAGHAAAMIAIVWAISICISIPPLFWRQARAHEEISDCLVNTSQISYTIY
STCGAFYIPSLLLIILYGRIYRAARNRILNPPSLYGKRFTTAHLITGSAGSSLCSLNPSL
HEGHSHSAGSPLFFNHVKIKLADSVLERKRISAARERKATKTLGIILGAFIICWLPFFVA
SLVLPICRDSCWIHPALFDFFTWLGYLNSLINPIIYTVFNEEFRQAFQKVV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50213961
n/a
NameBDBM50213961
Synonyms:CHEMBL53739
TypeSmall organic molecule
Emp. Form.C16H19N5
Mol. Mass.281.3556
SMILESCN1CCC(CC1)c1c[nH]c2ccc(cc12)-n1cnnc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: