Reaction Details |
| Report a problem with these data |
Target | Isoleucyl-tRNA synthetase |
---|
Ligand | BDBM50217847 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_88825 (CHEMBL698880) |
---|
IC50 | <1780±n/a nM |
---|
Citation | Shimizu, T; Usui, T; Machida, K; Furuya, K; Osada, H; Nakata, T Chemical modification of reveromycin A and its biological activities. Bioorg Med Chem Lett12:3363-6 (2002) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Isoleucyl-tRNA synthetase |
---|
Name: | Isoleucyl-tRNA synthetase |
Synonyms: | n/a |
Type: | PROTEIN |
Mol. Mass.: | 5742.00 |
Organism: | Rattus norvegicus |
Description: | ChEMBL_88824 |
Residue: | 50 |
Sequence: | MQTSLGNFVTTTGISSTRTPRPRRESVYFDLIKLKIFHQITQENPGSRNI
|
|
|
BDBM50217847 |
---|
n/a |
---|
Name | BDBM50217847 |
Synonyms: | CHEMBL114741 |
Type | Small organic molecule |
Emp. Form. | C32H48O8 |
Mol. Mass. | 560.7187 |
SMILES | [H][C@]1(C\C=C(/C)\C=C\[C@H](O)[C@@H](C)\C=C\C(O)=O)O[C@@]2(CC[C@@](CCCC)(O2)[C@@H](O)\C=C\C(\C)=C\C(O)=O)CC[C@@H]1C |
Structure |
|