Reaction Details |
| Report a problem with these data |
Target | Dihydrofolate reductase |
---|
Ligand | BDBM50405977 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_54733 (CHEMBL668773) |
---|
Ki | 20±n/a nM |
---|
Citation | Li, RL; Dietrich, SW; Hansch, C Quantitative structure-selectivity relationships. Comparison of the inhibition of Escherichia coli and bovine liver dihydrofolate reductase by 5-(substituted-benzyl)-2,4-diaminopyrimidines. J Med Chem24:538-44 (1981) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Dihydrofolate reductase |
---|
Name: | Dihydrofolate reductase |
Synonyms: | Dihydrofolate reductase (F31V) | dfrA17 |
Type: | n/a |
Mol. Mass.: | 17532.46 |
Organism: | Escherichia coli |
Description: | n/a |
Residue: | 157 |
Sequence: | MKISLISAVSESGVIGSGPDIPWSVKGEQLLFKALTYNQWLLVGRKTFDSMGVLPNRKYA
VVSKNGISSSNENVLVFPSIENALKELSKVTDHVYVSGGGQIYNSLIEKADIIHLSTVHV
EVEGDIKFPIMPENFNLVFEQFFMSNINYTYQIWKKG
|
|
|
BDBM50405977 |
---|
n/a |
---|
Name | BDBM50405977 |
Synonyms: | CHEMBL277391 |
Type | Small organic molecule |
Emp. Form. | C13H13F3N4O |
Mol. Mass. | 298.2637 |
SMILES | COc1ccc(Cc2cnc(N)nc2N)cc1C(F)(F)F |
Structure |
|