| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dihydrofolate reductase type 1 |
|---|
| Ligand | BDBM50291806 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_54572 (CHEMBL664886) |
|---|
| Ki | 977±n/a nM |
|---|
| Citation |  Coats, EA; Genther, CS; Selassie, CD; Strong, CD; Hansch, C Quantitative structure-activity relationship of antifolate inhibition of bacteria cell cultures resistant and sensitive to methotrexate. J Med Chem28:1910-6 (1985) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Dihydrofolate reductase type 1 |
|---|
| Name: | Dihydrofolate reductase type 1 |
|---|
| Synonyms: | DYR1_ECOLX | dhfrI |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 17574.87 |
|---|
| Organism: | Escherichia coli |
|---|
| Description: | ChEMBL_54248 |
|---|
| Residue: | 157 |
|---|
| Sequence: | MKLSLMVAISKNGVIGNGPDIPWSAKGEQLLFKAITYNQWLLVGRKTFESMGALPNRKYA
VVTRSSFTSDNENVLIFPSIKDALTNLKKITDHVIVSGGGEIYKSLIDQVDTLHISTIDI
EPEGDVYFPEIPSNFRPVFTQDFASNINYSYQIWQKG
|
|
|
|---|
| BDBM50291806 |
|---|
| n/a |
|---|
| Name | BDBM50291806 |
|---|
| Synonyms: | 1-[3-(Adamantan-1-ylmethoxy)-phenyl]-6,6-dimethyl-1,6-dihydro-[1,3,5]triazine-2,4-diamine | CHEMBL281618 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H31N5O |
|---|
| Mol. Mass. | 381.5144 |
|---|
| SMILES | CC1(C)N=C(N)N=C(N)N1c1cccc(OCC23CC4CC(CC(C4)C2)C3)c1 |t:3,6,TLB:24:23:26:19.18.20,24:19:26:23.25.22,20:21:25:19.18.24,THB:20:19:25:21.26.22,22:21:18:23.25.24,22:23:18:21.26.20| |
|---|
| Structure | 
|
|---|
Search and Browse
