Reaction Details |
| Report a problem with these data |
Target | Dihydrofolate reductase |
---|
Ligand | BDBM50405989 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_54731 |
---|
Ki | 0.776247±n/a nM |
---|
Citation | Li, RL; Poe, M Quantitative structure-activity relationships for the inhibition of Escherichia coli dihydrofolate reductase by 5-(substituted benzyl)-2,4-diaminopyrimidines. J Med Chem31:366-70 (1988) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Dihydrofolate reductase |
---|
Name: | Dihydrofolate reductase |
Synonyms: | Dihydrofolate reductase (F31V) | dfrA17 |
Type: | n/a |
Mol. Mass.: | 17532.46 |
Organism: | Escherichia coli |
Description: | n/a |
Residue: | 157 |
Sequence: | MKISLISAVSESGVIGSGPDIPWSVKGEQLLFKALTYNQWLLVGRKTFDSMGVLPNRKYA
VVSKNGISSSNENVLVFPSIENALKELSKVTDHVYVSGGGQIYNSLIEKADIIHLSTVHV
EVEGDIKFPIMPENFNLVFEQFFMSNINYTYQIWKKG
|
|
|
BDBM50405989 |
---|
n/a |
---|
Name | BDBM50405989 |
Synonyms: | CHEMBL60913 |
Type | Small organic molecule |
Emp. Form. | C15H20N4O2 |
Mol. Mass. | 288.3449 |
SMILES | CCOc1cc(Cc2cnc(N)nc2N)cc(OCC)c1 |
Structure |
|