| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dihydrofolate reductase |
|---|
| Ligand | BDBM50405087 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_54735 (CHEMBL667186) |
|---|
| Ki | 954±n/a nM |
|---|
| Citation |  Doweyko, AM The hypothetical active site lattice. An approach to modelling active sites from data on inhibitor molecules. J Med Chem31:1396-406 (1988) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Dihydrofolate reductase |
|---|
| Name: | Dihydrofolate reductase |
|---|
| Synonyms: | Dihydrofolate reductase (F31V) | dfrA17 |
|---|
| Type: | n/a |
|---|
| Mol. Mass.: | 17532.46 |
|---|
| Organism: | Escherichia coli |
|---|
| Description: | n/a |
|---|
| Residue: | 157 |
|---|
| Sequence: | MKISLISAVSESGVIGSGPDIPWSVKGEQLLFKALTYNQWLLVGRKTFDSMGVLPNRKYA
VVSKNGISSSNENVLVFPSIENALKELSKVTDHVYVSGGGQIYNSLIEKADIIHLSTVHV
EVEGDIKFPIMPENFNLVFEQFFMSNINYTYQIWKKG
|
|
|
|---|
| BDBM50405087 |
|---|
| n/a |
|---|
| Name | BDBM50405087 |
|---|
| Synonyms: | CHEMBL7435 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C15H23N5O |
|---|
| Mol. Mass. | 289.376 |
|---|
| SMILES | CCCCOc1cccc(c1)N1C(N)=NC(N)=NC1(C)C |c:14,17| |
|---|
| Structure | 
|
|---|
Search and Browse
