Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetcAMP-dependent protein kinase (PKA)
LigandBDBM50228839
Substrate/Competitorn/a
Meas. Tech.ChEMBL_161405
Ki 170±n/a nM
Citation Ricouart AGesquiere JCTartar ASergheraert C Design of potent protein kinase inhibitors using the bisubstrate approach. J Med Chem 34:73-8 (1991) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
cAMP-dependent protein kinase (PKA)
Name:cAMP-dependent protein kinase (PKA)
Synonyms:PKA C-gamma | PRKACG | cAMP-dependent protein kinase catalytic subunit gamma
Type:PROTEIN
Mol. Mass.:40442.03
Organism:Homo sapiens (Human)
Description:ChEMBL_104720
Residue:351
Sequence:
MGNAPAKKDTEQEESVNEFLAKARGDFLYRWGNPAQNTASSDQFERLRTLGMGSFGRVML
VRHQETGGHYAMKILNKQKVVKMKQVEHILNEKRILQAIDFPFLVKLQFSFKDNSYLYLV
MEYVPGGEMFSRLQRVGRFSEPHACFYAAQVVLAVQYLHSLDLIHRDLKPENLLIDQQGY
LQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAVGFPPFY
ADQPIQIYEKIVSGRVRFPSKLSSDLKHLLRSLLQVDLTKRFGNLRNGVGDIKNHKWFAT
TSWIAIYEKKVEAPFIPKYTGPGDASNFDDYEEEELRISINEKCAKEFSEF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50228839
n/a
NameBDBM50228839
Synonyms:CHEMBL415414
TypeSmall organic molecule
Emp. Form.C54H94N28O13S
Mol. Mass.1375.569
SMILES[#6]-[#6@H](-[#7]-[#6](=O)-[#6@H](-[#6])-[#7]S(=O)(=O)c1cccc2cnccc12)-[#6](=O)-[#7]-[#6@@H](-[#6]-[#8])-[#6](=O)-[#7]-[#6@@H](-[#6]-[#6]-[#6]\[#7]=[#6](\[#7])-[#7])-[#6](=O)-[#7]-[#6@@H](-[#6]-[#6]-[#6]\[#7]=[#6](\[#7])-[#7])-[#6](=O)-[#7]-[#6@@H](-[#6]-[#6]-[#6]\[#7]=[#6](\[#7])-[#7])-[#6](=O)-[#7]-[#6@@H](-[#6]-[#6]-[#6]\[#7]=[#6](\[#7])-[#7])-[#6](=O)-[#7]-[#6@@H](-[#6]-[#6]-[#6]\[#7]=[#6](\[#7])-[#7])-[#6](=O)-[#7]-[#6@@H](-[#6]-[#6]-[#6]\[#7]=[#6](\[#7])-[#7])-[#6](-[#8])=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: