Reaction Details |
| Report a problem with these data |
Target | Translocator protein |
---|
Ligand | BDBM50232182 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1646138 (CHEMBL3995194) |
---|
Ki | 1.7±n/a nM |
---|
Citation | Cherukupalli, S; Karpoormath, R; Chandrasekaran, B; Hampannavar, GA; Thapliyal, N; Palakollu, VN An insight on synthetic and medicinal aspects of pyrazolo[1,5-a]pyrimidine scaffold. Eur J Med Chem126:298-352 (2017) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Translocator protein |
---|
Name: | Translocator protein |
Synonyms: | Benzodiazepine receptors; peripheral & central | Bzrp | Mbr | Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor (PBR) | Peripheral-Type Benzodiazepine Receptor | TSPO_RAT | Tspo |
Type: | Mitochondrion membrane protein |
Mol. Mass.: | 18945.84 |
Organism: | Rattus norvegicus (rat) |
Description: | Competitive binding experiments were performed on rat kidney mitochondrial membranes. |
Residue: | 169 |
Sequence: | MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAM
GYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVAT
ATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE
|
|
|
BDBM50232182 |
---|
n/a |
---|
Name | BDBM50232182 |
Synonyms: | CHEMBL4097327 |
Type | Small organic molecule |
Emp. Form. | C22H27N3O |
Mol. Mass. | 349.4693 |
SMILES | CCC(CC)C(=O)Cc1c(nn2c(C)cc(C)nc12)-c1ccc(C)cc1 |
Structure |
|