Reaction Details |
| Report a problem with these data |
Target | Orexin receptor type 2 |
---|
Ligand | BDBM203999 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1650586 (CHEMBL3999720) |
---|
IC50 | 13±n/a nM |
---|
Citation | Skudlarek, JW; DiMarco, CN; Babaoglu, K; Roecker, AJ; Bruno, JG; Pausch, MA; O'Brien, JA; Cabalu, TD; Stevens, J; Brunner, J; Tannenbaum, PL; Wuelfing, WP; Garson, SL; Fox, SV; Savitz, AT; Harrell, CM; Gotter, AL; Winrow, CJ; Renger, JJ; Kuduk, SD; Coleman, PJ Investigation of orexin-2 selective receptor antagonists: Structural modifications resulting in dual orexin receptor antagonists. Bioorg Med Chem Lett27:1364-1370 (2017) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Orexin receptor type 2 |
---|
Name: | Orexin receptor type 2 |
Synonyms: | HCRTR2 | Hypocretin receptor type 2 | OX2R_HUMAN | Orexin receptor type 2 (OR 2) | Orexin receptor type 2 (OR-2) | Orexin receptor type 2 (OX2) | Orexin receptor type 2 (OX2R) | Orexin receptor type 2 (OxR2) | Ox-2-R | Ox2-R |
Type: | Protein |
Mol. Mass.: | 50710.53 |
Organism: | Homo sapiens (Human) |
Description: | O43614 |
Residue: | 444 |
Sequence: | MSGTKLEDSPPCRNWSSASELNETQEPFLNPTDYDDEEFLRYLWREYLHPKEYEWVLIAG
YIIVFVVALIGNVLVCVAVWKNHHMRTVTNYFIVNLSLADVLVTITCLPATLVVDITETW
FFGQSLCKVIPYLQTVSVSVSVLTLSCIALDRWYAICHPLMFKSTAKRARNSIVIIWIVS
CIIMIPQAIVMECSTVFPGLANKTTLFTVCDERWGGEIYPKMYHICFFLVTYMAPLCLMV
LAYLQIFRKLWCRQIPGTSSVVQRKWKPLQPVSQPRGPGQPTKSRMSAVAAEIKQIRARR
KTARMLMIVLLVFAICYLPISILNVLKRVFGMFAHTEDRETVYAWFTFSHWLVYANSAAN
PIIYNFLSGKFREEFKAAFSCCCLGVHHRQEDRLTRGRTSTESRKSLTTQISNFDNISKL
SEQVVLTSISTLPAANGAGPLQNW
|
|
|
BDBM203999 |
---|
n/a |
---|
Name | BDBM203999 |
Synonyms: | 2-{[(3r,6r)-1-{[4-methoxy-2- (2h-1,2,3-triazol-2- yl)phenyl]carbonyl}-6- methylpiperidin-3-yl]oxy}-3- methylpyridine-4-carbonitrile | US9546152, example 7 |
Type | Small organic molecule |
Emp. Form. | C23H24N6O3 |
Mol. Mass. | 432.4751 |
SMILES | COc1ccc(C(=O)N2C[C@@H](CC[C@H]2C)Oc2nccc(C#N)c2C)c(c1)-n1nccn1 |r| |
Structure |
|