| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Orexin/Hypocretin receptor type 1 |
|---|
| Ligand | BDBM50233293 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1650587 (CHEMBL3999721) |
|---|
| IC50 | 48±n/a nM |
|---|
| Citation |  Skudlarek, JW; DiMarco, CN; Babaoglu, K; Roecker, AJ; Bruno, JG; Pausch, MA; O'Brien, JA; Cabalu, TD; Stevens, J; Brunner, J; Tannenbaum, PL; Wuelfing, WP; Garson, SL; Fox, SV; Savitz, AT; Harrell, CM; Gotter, AL; Winrow, CJ; Renger, JJ; Kuduk, SD; Coleman, PJ Investigation of orexin-2 selective receptor antagonists: Structural modifications resulting in dual orexin receptor antagonists. Bioorg Med Chem Lett27:1364-1370 (2017) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Orexin/Hypocretin receptor type 1 |
|---|
| Name: | Orexin/Hypocretin receptor type 1 |
|---|
| Synonyms: | HCRTR1 | Hypocretin receptor type 1 | OX1R_HUMAN | Orexin receptor type 1 | Orexin receptor type 1 (OR 1) | Orexin receptor type 1 (OR-1) | Orexin receptor type 1 (OX1) | Orexin receptor type 1 (OX1R) | Orexin receptor type 1 (OxR1) | Ox1r |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 47554.50 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | O43613 |
|---|
| Residue: | 425 |
|---|
| Sequence: | MEPSATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYEWVLIAAYVAVFVVA
LVGNTLVCLAVWRNHHMRTVTNYFIVNLSLADVLVTAICLPASLLVDITESWLFGHALCK
VIPYLQAVSVSVAVLTLSFIALDRWYAICHPLLFKSTARRARGSILGIWAVSLAIMVPQA
AVMECSSVLPELANRTRLFSVCDERWADDLYPKIYHSCFFIVTYLAPLGLMAMAYFQIFR
KLWGRQIPGTTSALVRNWKRPSDQLGDLEQGLSGEPQPRARAFLAEVKQMRARRKTAKML
MVVLLVFALCYLPISVLNVLKRVFGMFRQASDREAVYACFTFSHWLVYANSAANPIIYNF
LSGKFREQFKAAFSCCLPGLGPCGSLKAPSPRSSASHKSLSLQSRCSISKISEHVVLTSV
TTVLP
|
|
|
|---|
| BDBM50233293 |
|---|
| n/a |
|---|
| Name | BDBM50233293 |
|---|
| Synonyms: | CHEMBL4096735 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H23N5O3S |
|---|
| Mol. Mass. | 437.515 |
|---|
| SMILES | COC(=O)c1cccnc1S[C@@H]1CC[C@@H](C)N(C1)C(=O)c1ccccc1-n1nccn1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
