| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Carbonic anhydrase 1 |
|---|
| Ligand | BDBM50013792 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_1652370 |
|---|
| Ki | 50±n/a nM |
|---|
| Citation |  Del Prete, S; Vullo, D; Di Fonzo, P; Osman, SM; AlOthman, Z; Donald, WA; Supuran, CT; Capasso, C Sulfonamide inhibition profile of theż-carbonic anhydrase identified in the genome of the pathogenic bacterium Burkholderia pseudomallei the etiological agent responsible of melioidosis. Bioorg Med Chem Lett27:490-495 (2017) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Carbonic anhydrase 1 |
|---|
| Name: | Carbonic anhydrase 1 |
|---|
| Synonyms: | CA-I | CA1 | CAB | CAH1_HUMAN | Carbonate dehydratase I | Carbonic anhydrase | Carbonic anhydrase 1 (CA I) | Carbonic anhydrase 1 (CA-I) | Carbonic anhydrase 1 (Recombinant CA I) | Carbonic anhydrase 2 (CA II) | Carbonic anhydrase B | Carbonic anhydrase I | Carbonic anhydrase I (CA I) | Carbonic anhydrase I (CA-I) | Carbonic anhydrase I (CAI) | Carbonic anhydrase I (hCA I) | Carbonic anhydrase isoenzyme I (hCA I) | hCA |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 28873.37 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P00915 |
|---|
| Residue: | 261 |
|---|
| Sequence: | MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEI
INVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELH
VAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNF
DPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAV
PMQHNNRPTQPLKGRTVRASF
|
|
|
|---|
| BDBM50013792 |
|---|
| n/a |
|---|
| Name | BDBM50013792 |
|---|
| Synonyms: | CHEBI:6822 | METHAZOLAMIDE | Neptazane |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C5H8N4O3S2 |
|---|
| Mol. Mass. | 236.272 |
|---|
| SMILES | CC(=O)\N=c1\sc(nn1C)S(N)(=O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
