Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCDC2-like kinase 3 (CLK3)
LigandBDBM50234808
Substrate/Competitorn/a
Meas. Tech.ChEBML_1654001
IC50 530±n/a nM
Citation Murár MDobia? J?ramel PAddová GHanquet GBohác A Novel CLK1 inhibitors based on N-aryloxazol-2-amine skeleton - A possible way to dual VEGFR2 TK/CLK ligands. Eur J Med Chem 126:754-761 (2017) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
CDC2-like kinase 3 (CLK3)
Name:Dual specificity protein kinase CLK3
Synonyms:CLK3 | Dual specificity protein kinase CLK3
Type:Protein
Mol. Mass.:73570.11
Organism:Homo sapiens (Human)
Description:n/a
Residue:638
Sequence:
MPVLSARRRELADHAGSGRRSGPSPTARSGPHLSALRAQPARAAHLSGRGTYVRRDTAGG
GPGQARPLGPPGTSLLGRGARRSGEGWCPGAFESGARAARPPSRVEPRLATAASREGAGL
PRAEVAAGSGRGARSGEWGLAAAGAWETMHHCKRYRSPEPDPYLSYRWKRRRSYSREHEG
RLRYPSRREPPPRRSRSRSHDRLPYQRRYRERRDSDTYRCEERSPSFGEDYYGPSRSRHR
RRSRERGPYRTRKHAHHCHKRRTRSCSSASSRSQQSSKRSSRSVEDDKEGHLVCRIGDWL
QERYEIVGNLGEGTFGKVVECLDHARGKSQVALKIIRNVGKYREAARLEINVLKKIKEKD
KENKFLCVLMSDWFNFHGHMCIAFELLGKNTFEFLKENNFQPYPLPHVRHMAYQLCHALR
FLHENQLTHTDLKPENILFVNSEFETLYNEHKSCEEKSVKNTSIRVADFGSATFDHEHHT
TIVATRHYRPPEVILELGWAQPCDVWSIGCILFEYYRGFTLFQTHENREHLVMMEKILGP
IPSHMIHRTRKQKYFYKGGLVWDENSSDGRYVKENCKPLKSYMLQDSLEHVQLFDLMRRM
LEFDPAQRITLAEALLHPFFAGLTPEERSFHTSRNPSR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50234808
n/a
NameBDBM50234808
Synonyms:CHEMBL4090007
TypeSmall organic molecule
Emp. Form.C15H13Cl2N3O2
Mol. Mass.338.189
SMILESCCOC(=O)c1c(\C(=C\N)C#N)c2ccc(Cl)c(Cl)c2n1C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: