| Reaction Details |
|---|
 | Report a problem with these data |
| Target | NAD-dependent protein deacetylase sirtuin-2 |
|---|
| Ligand | BDBM50236570 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1660310 (CHEMBL4009922) |
|---|
| Ki | 2220±n/a nM |
|---|
| Citation |  Moniot, S; Forgione, M; Lucidi, A; Hailu, GS; Nebbioso, A; Carafa, V; Baratta, F; Altucci, L; Giacché, N; Passeri, D; Pellicciari, R; Mai, A; Steegborn, C; Rotili, D Development of 1,2,4-Oxadiazoles as Potent and Selective Inhibitors of the Human Deacetylase Sirtuin 2: Structure-Activity Relationship, X-ray Crystal Structure, and Anticancer Activity. J Med Chem60:2344-2360 (2017) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| NAD-dependent protein deacetylase sirtuin-2 |
|---|
| Name: | NAD-dependent protein deacetylase sirtuin-2 |
|---|
| Synonyms: | NAD-Dependent Deacetylase Sirtuin-2 | NAD-dependent deacetylase sirtuin 2 | NAD-dependent deacetylase sirtuin 3 | NAD-dependent protein deacetylase sirtuin-2 (SIRT2) | SIR2-like | SIR2-like protein 2 | SIR2L | SIR2L2 | SIR2_HUMAN | SIRT2 | Sirtuin 2 (SIRT2) |
|---|
| Type: | Hydrolase |
|---|
| Mol. Mass.: | 43172.62 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 389 |
|---|
| Sequence: | MAEPDPSHPLETQAGKVQEAQDSDSDSEGGAAGGEADMDFLRNLFSQTLSLGSQKERLLD
ELTLEGVARYMQSERCRRVICLVGAGISTSAGIPDFRSPSTGLYDNLEKYHLPYPEAIFE
ISYFKKHPEPFFALAKELYPGQFKPTICHYFMRLLKDKGLLLRCYTQNIDTLERIAGLEQ
EDLVEAHGTFYTSHCVSASCRHEYPLSWMKEKIFSEVTPKCEDCQSLVKPDIVFFGESLP
ARFFSCMQSDFLKVDLLLVMGTSLQVQPFASLISKAPLSTPRLLINKEKAGQSDPFLGMI
MGLGGGMDFDSKKAYRDVAWLGECDQGCLALAELLGWKKELEDLVRREHASIDAQSGAGV
PNPSTSASPKKSPPPAKDEARTTEREKPQ
|
|
|
|---|
| BDBM50236570 |
|---|
| n/a |
|---|
| Name | BDBM50236570 |
|---|
| Synonyms: | CHEMBL4072206 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C11H10Br2N2O |
|---|
| Mol. Mass. | 346.018 |
|---|
| SMILES | BrCCCc1nc(no1)-c1ccc(Br)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
