Reaction Details |
| Report a problem with these data |
Target | Mu-type opioid receptor |
---|
Ligand | BDBM50236878 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1659530 (CHEMBL4009142) |
---|
Ki | 91±n/a nM |
---|
Citation | Soeberdt, M; Molenveld, P; Storcken, RP; Bouzanne des Mazery, R; Sterk, GJ; Autar, R; Bolster, MG; Wagner, C; Aerts, SN; van Holst, FR; Wegert, A; Tangherlini, G; Frehland, B; Schepmann, D; Metze, D; Lotts, T; Knie, U; Lin, KY; Huang, TY; Lai, CC; Ständer, S; Wünsch, B; Abels, C Design and Synthesis of Enantiomerically Pure Decahydroquinoxalines as Potent and Selective¿-Opioid Receptor Agonists with Anti-Inflammatory Activity in Vivo. J Med Chem60:2526-2551 (2017) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Mu-type opioid receptor |
---|
Name: | Mu-type opioid receptor |
Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 11165.58 |
Organism: | GUINEA PIG |
Description: | P97266 |
Residue: | 98 |
Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
BDBM50236878 |
---|
n/a |
---|
Name | BDBM50236878 |
Synonyms: | CHEMBL4084350 |
Type | Small organic molecule |
Emp. Form. | C21H29Cl2N3O3S |
Mol. Mass. | 474.444 |
SMILES | [H][C@]12CCC[C@H](N3CCCC3)[C@@]1([H])N(CCN2S(C)(=O)=O)C(=O)Cc1ccc(Cl)c(Cl)c1 |r| |
Structure |
|