Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPurinergic receptor P2Y2
LigandBDBM50237574
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1661641
IC50 6520±n/a nM
Citation Rafehi MMalik EMNeumann AAbdelrahman AHanck TNamasivayam VMüller CEBaqi Y Development of Potent and Selective Antagonists for the UTP-Activated P2Y J Med Chem 60:3020-3038 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Purinergic receptor P2Y2
Name:Purinergic receptor P2Y2
Synonyms:ATP receptor | P2U purinoceptor 1 | P2U1 | P2Y purinoceptor 2 | P2Y2 | Purinergic receptor
Type:PROTEIN
Mol. Mass.:42299.21
Organism:Homo sapiens (Human)
Description:ChEMBL_1455361
Residue:377
Sequence:
MAADLGPWNDTINGTWDGDELGYRCRFNEDFKYVLLPVSYGVVCVPGLCLNAVALYIFLC
RLKTWNASTTYMFHLAVSDALYAASLPLLVYYYARGDHWPFSTVLCKLVRFLFYTNLYCS
ILFLTCISVHRCLGVLRPLRSLRWGRARYARRVAGAVWVLVLACQAPVLYFVTTSARGGR
VTCHDTSAPELFSRFVAYSSVMLGLLFAVPFAVILVCYVLMARRLLKPAYGTSGGLPRAK
RKSVRTIAVVLAVFALCFLPFHVTRTLYYSFRSLDLSCHTLNAINMAYKVTRPLASANSC
LDPVLYFLAGQRLVRFARDAKPPTGPSPATPARRRLGLRRSDRTDMQRIEDVLGSSEDSR
RTESTPAGSENTKDIRL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50237574
n/a
NameBDBM50237574
Synonyms:CHEMBL4081274
TypeSmall organic molecule
Emp. Form.C28H21N2NaO5S2
Mol. Mass.552.597
SMILES[Na+].Cc1ccc(C)c(Sc2ccc(Nc3cc(c(N)c4C(=O)c5ccccc5C(=O)c34)S([O-])(=O)=O)cc2)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: