Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPyrimidinergic receptor P2Y6
LigandBDBM50237574
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1661642
IC50 2670±n/a nM
Citation Rafehi MMalik EMNeumann AAbdelrahman AHanck TNamasivayam VMüller CEBaqi Y Development of Potent and Selective Antagonists for the UTP-Activated P2Y J Med Chem 60:3020-3038 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Pyrimidinergic receptor P2Y6
Name:Pyrimidinergic receptor P2Y6
Synonyms:P2Y purinoceptor 6 | P2Y6
Type:PROTEIN
Mol. Mass.:36452.29
Organism:Homo sapiens (Human)
Description:ChEMBL_1511151
Residue:328
Sequence:
MEWDNGTGQALGLPPTTCVYRENFKQLLLPPVYSAVLAAGLPLNICVITQICTSRRALTR
TAVYTLNLALADLLYACSLPLLIYNYAQGDHWPFGDFACRLVRFLFYANLHGSILFLTCI
SFQRYLGICHPLAPWHKRGGRRAAWLVCVAVWLAVTTQCLPTAIFAATGIQRNRTVCYDL
SPPALATHYMPYGMALTVIGFLLPFAALLACYCLLACRLCRQDGPAEPVAQERRGKAARM
AVVVAAAFAISFLPFHITKTAYLAVRSTPGVPCTVLEAFAAAYKGTRPFASANSVLDPIL
FYFTQKKFRRRPHELLQKLTAKWQRQGR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50237574
n/a
NameBDBM50237574
Synonyms:CHEMBL4081274
TypeSmall organic molecule
Emp. Form.C28H21N2NaO5S2
Mol. Mass.552.597
SMILES[Na+].Cc1ccc(C)c(Sc2ccc(Nc3cc(c(N)c4C(=O)c5ccccc5C(=O)c34)S([O-])(=O)=O)cc2)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: