Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPurinergic receptor P2Y12
LigandBDBM50237573
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1661643
IC50 3590±n/a nM
Citation Rafehi MMalik EMNeumann AAbdelrahman AHanck TNamasivayam VMüller CEBaqi Y Development of Potent and Selective Antagonists for the UTP-Activated P2Y J Med Chem 60:3020-3038 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Purinergic receptor P2Y12
Name:Purinergic receptor P2Y12
Synonyms:ADP-glucose receptor | ADPG-R | P2T(AC) | P2Y purinoceptor 12 | P2Y(AC) | P2Y(ADP) | P2Y(cyc) | P2Y12 | P2Y12 platelet ADP receptor | SP1999
Type:Enzyme
Mol. Mass.:39458.48
Organism:Homo sapiens (Human)
Description:Q9H244
Residue:342
Sequence:
MQAVDNLTSAPGNTSLCTRDYKITQVLFPLLYTVLFFVGLITNGLAMRIFFQIRSKSNFI
IFLKNTVISDLLMILTFPFKILSDAKLGTGPLRTFVCQVTSVIFYFTMYISISFLGLITI
DRYQKTTRPFKTSNPKNLLGAKILSVVIWAFMFLLSLPNMILTNRQPRDKNVKKCSFLKS
EFGLVWHEIVNYICQVIFWINFLIVIVCYTLITKELYRSYVRTRGVGKVPRKKVNVKVFI
IIAVFFICFVPFHFARIPYTLSQTRDVFDCTAENTLFYVKESTLWLTSLNACLDPFIYFF
LCKSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50237573
n/a
NameBDBM50237573
Synonyms:CHEMBL4090874
TypeSmall organic molecule
Emp. Form.C26H18N3NaO5S2
Mol. Mass.539.558
SMILES[Na+].Nc1c(cc(Nc2ccc(SCc3cccnc3)cc2)c2C(=O)c3ccccc3C(=O)c12)S([O-])(=O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: