| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Interleukin-2 |
|---|
| Ligand | BDBM50238649 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_1664050 |
|---|
| Kd | 8000±n/a nM |
|---|
| Citation |  Quéméner, A; Maillasson, M; Arzel, L; Sicard, B; Vomiandry, R; Mortier, E; Dubreuil, D; Jacques, Y; Lebreton, J; Mathé-Allainmat, M Discovery of a Small-Molecule Inhibitor of Interleukin 15: Pharmacophore-Based Virtual Screening and Hit Optimization. J Med Chem60:6249-6272 (2017) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Interleukin-2 |
|---|
| Name: | Interleukin-2 |
|---|
| Synonyms: | IL-2 | IL2 | IL2_HUMAN | INN=Aldesleukin | Interleukin-2 | Interleukin-2 (IL-2) | T-cell growth factor | TCGF |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 17630.05 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P60568 |
|---|
| Residue: | 153 |
|---|
| Sequence: | MYRMQLLSCIALSLALVTNSAPTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRML
TFKFYMPKKATELKHLQCLEEELKPLEEVLNLAQSKNFHLRPRDLISNINVIVLELKGSE
TTFMCEYADETATIVEFLNRWITFCQSIISTLT
|
|
|
|---|
| BDBM50238649 |
|---|
| n/a |
|---|
| Name | BDBM50238649 |
|---|
| Synonyms: | CHEMBL4103753 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C27H30Cl2N6O2S |
|---|
| Mol. Mass. | 573.537 |
|---|
| SMILES | Cn1c(Cc2nn(C)c(=O)c3ccccc23)nnc1SCCCCCCCC(=O)Nc1ccc(Cl)cc1Cl |
|---|
| Structure | 
|
|---|
Search and Browse
