Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-HT5
LigandBDBM55121
Substrate/Competitorn/a
Ki>10000±n/a nM
CommentsPDSP_728
Citation Matthes HBoschert UAmlaiky NGrailhe RPlassat JLMuscatelli FMattei MGHen R Mouse 5-hydroxytryptamine5A and 5-hydroxytryptamine5B receptors define a new family of serotonin receptors: cloning, functional expression, and chromosomal localization. Mol Pharmacol 43:313-9 (1993) [PubMed]
More Info.:Get all data from this article
 
5-HT5
Name:5-HT5
Synonyms:5-HT-5 | 5-HT-5A | 5-HT5a | 5-hydroxytryptamine receptor 5A | Serotonin 5a (5-HT5a) receptor | Serotonin receptor 5A
Type:Enzyme Catalytic Domain
Mol. Mass.:40749.33
Organism:MOUSE
Description:5-HT5 0 MOUSE::P30966
Residue:357
Sequence:
MDLPVNLTSFSLSTPSSLEPNRSLDTEVLRPSRPFLSAFRVLVLTLLGFLAAATFTWNLL
VLATILKVRTFHRVPHNLVASMAISDVLVAVLVMPLSLVHELSGRRWQLGRRLCQLWIAC
DVLCCTASIWNVTAIALDRYWSITRHLEYTLRTRKRVSNVMILLTWALSTVISLAPLLFG
WGETYSEPSEECQVSREPSYTVFSTVGAFYLPLCVVLFVYWKIYRAAKFRMGSRKTNSVS
PVPEAVEVKNATQHPQMVFTVRHATVTFQTEGDTWREQKEQRAALMVGILIGVFVLCWFP
FFVTELISPLCSWDVPAIWKSIFLWLGYSNSFFNPLIYTAFNRSYSSAFKVFFSKQQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM55121
n/a
NameBDBM55121
Synonyms:3-HYDROXYTYRAMINE HYDROCHLORIDE | 4-(2-aminoethyl)benzene-1,2-diol;hydrochloride | 4-(2-aminoethyl)pyrocatechol;hydrochloride | 4-(2-azanylethyl)benzene-1,2-diol;hydrochloride | DOPAMINE | Dopamine | MLS000069419 | SMR000059081 | cid_65340
TypeSmall organic molecule
Emp. Form.C8H11NO2
Mol. Mass.153.1784
SMILESNCCc1ccc(O)c(O)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: