Reaction Details |
| Report a problem with these data |
Target | cAMP-dependent protein kinase catalytic subunit alpha |
---|
Ligand | BDBM3149 |
---|
Substrate/Competitor | Histone type HL |
---|
Meas. Tech. | PKA assay |
---|
IC50 | 40±n/a nM |
---|
Citation | Defauw, JM; Murphy, MM; Jagdmann, GE; Hu, H; Lampe, JW; Hollinshead, SP; Mitchell, TJ; Crane, HM; Heerding, JM; Mendoza, JS; Davis, JE; Darges, JW; Hubbard, FR; Hall, SE Synthesis and protein kinase C inhibitory activities of acyclic balanol analogs that are highly selective for protein kinase C over protein kinase A. J Med Chem39:5215-27 (1996) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
cAMP-dependent protein kinase catalytic subunit alpha |
---|
Name: | cAMP-dependent protein kinase catalytic subunit alpha |
Synonyms: | KAPCA_BOVIN | PKA C-alpha | PKC | PRKACA | Protein Kinase C | Protein Kinase C, bovine brain | cAMP-Dependent Protein Kinase (PKA) | cAMP-dependent Protein Kinase, bovine heart | cAMP-dependent protein kinase A | cAMP-dependent protein kinase alpha-catalytic subunit | cAMP-dependent protein kinase, alpha-catalytic subunit |
Type: | Enzyme Complex |
Mol. Mass.: | 40627.77 |
Organism: | Bos taurus (bovine) |
Description: | The PKA holoenzyme purified from bovine heart, exists as an inactive tetrameric complex, which consists of a regulatory dimer associated with two catalytic subunits. It requires cAMP to activate the enzymatic reaction. |
Residue: | 351 |
Sequence: | MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVML
VKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMV
MEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGY
IQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFF
ADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFAT
TDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF
|
|
|
BDBM3149 |
---|
Histone type HL |
---|
Name: | Histone type HL |
Synonyms: | n/a |
Type: | Peptide |
Mol. Mass.: | 358.43 |
Organism: | n/a |
Description: | unfractionated histone (Worthington)
30 uM [gamma-32P]ATP as co-substrate. |
Residue: | 3 |
Sequence: | |