Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDopamine receptor
LigandBDBM50007692
Substrate/Competitorn/a
Ki 13.6±n/a nM
CommentsPDSP_1858
Citation Roth BLTandra SBurgess LHSibley DRMeltzer HY D4 dopamine receptor binding affinity does not distinguish between typical and atypical antipsychotic drugs. Psychopharmacology (Berl) 120:365-8 (1995) [PubMed]  Article
More Info.:Get all data from this article
 
Dopamine receptor
Name:Dopamine receptor
Synonyms:D(4) dopamine receptor | DOPAMINE D4 | DOPAMINE D4.4
Type:Enzyme Catalytic Domain
Mol. Mass.:41307.65
Organism:RAT
Description:DOPAMINE D4.4 0 RAT::P30729
Residue:387
Sequence:
MGNSSATGDGGLLAGRGPESLGTGTGLGGAGAAALVGGVLLIGMVLAGNSLVCVSVASER
ILQTPTNYFIVSLAAADLLLAVLVLPLFVYSEVQGGVWLLSPRLCDTLMAMDVMLCTASI
FNLCAISVDRFVAVTVPLRYNQQGQCQLLLIAATWLLSAAVAAPVVCGLNDVPGRDPTVC
CLEDRDYVVYSSICSFFLPCPLMLLLYWATFRGLRRWEAARHTKLHSRAPRRPSGPGPPV
SDPTQGPLFSDCPPPSPSLRTSPTVSSRPESDLSQSPCSPGCLLPDAALAQPPAPSSRRK
RGAKITGRERKAMRVLPVVVGAFLMCWTPFFVVHITRALCPACFVSPRLVSAVTWLGYVN
SALNPIIYTIFNAEFRSVFRKTLRLRC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50007692
n/a
NameBDBM50007692
Synonyms:8-[4-(4-Benzo[d]isothiazol-3-yl-piperazin-1-yl)-butyl]-8-aza-spiro[4.5]decane-7,9-dione | CHEMBL1204189 | CHEMBL35057 | TIOSPERONE
TypeSmall organic molecule
Emp. Form.C24H32N4O2S
Mol. Mass.440.601
SMILESO=C1CC2(CCCC2)CC(=O)N1CCCCN1CCN(CC1)c1nsc2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: