| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Pro-neuropeptide Y |
|---|
| Ligand | BDBM82279 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | 1000±n/a nM |
|---|
| Comments | PDSP_1559 |
|---|
| Citation |  Yan, H; Yang, J; Marasco, J; Yamaguchi, K; Brenner, S; Collins, F; Karbon, W Cloning and functional expression of cDNAs encoding human and rat pancreatic polypeptide receptors. Proc Natl Acad Sci U S A93:4661-5 (1996) [PubMed] Article |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| Pro-neuropeptide Y |
|---|
| Name: | Pro-neuropeptide Y |
|---|
| Synonyms: | NPY | NPY_HUMAN | Neuropeptide Y | Pro-neuropeptide Y |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 10851.83 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Neuropeptide Y 0 HUMAN::P01303 |
|---|
| Residue: | 97 |
|---|
| Sequence: | MLGNKRLGLSGLTLALSLLVCLGALAEAYPSKPDNPGEDAPAEDMARYYSALRHYINLIT
RQRYGKRSSPETLISDLLMRESTENVPRTRLEDPAMW
|
|
|
|---|
| BDBM82279 |
|---|
| n/a |
|---|
| Name | BDBM82279 |
|---|
| Synonyms: | CAS_118997-30-1 | PYY, human |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C194H294N54O58 |
|---|
| Mol. Mass. | 4310.7372 |
|---|
| SMILES | n/a |
|---|
| Structure | 
|
|---|
Search and Browse
