| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Adrenergic alpha2 receptor |
|---|
| Ligand | BDBM82472 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | >10000±n/a nM |
|---|
| Comments | PDSP_456 |
|---|
| Citation |  Kennett, GA; Bright, F; Trail, B; Baxter, GS; Blackburn, TP Effects of the 5-HT2B receptor agonist, BW 723C86, on three rat models of anxiety. Br J Pharmacol117:1443-8 (1996) [PubMed] Article |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| Adrenergic alpha2 receptor |
|---|
| Name: | Adrenergic alpha2 receptor |
|---|
| Synonyms: | Adrenergic alpha2 receptor | adrenergic Alpha2 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 11420.09 |
|---|
| Organism: | Mesocricetus auratus |
|---|
| Description: | Q60533 |
|---|
| Residue: | 104 |
|---|
| Sequence: | RATPYSLQETLTLVCLAGLLMLFTVFGNVLVIIAVFTSRALKAPQNLFLVSLASADILVA
TLVIPFSLANEVMGYWYFGKVWCEIYLALDVLFCTSSIVHLCAI
|
|
|
|---|
| BDBM82472 |
|---|
| n/a |
|---|
| Name | BDBM82472 |
|---|
| Synonyms: | BW-723C86 | CAS_5311036 | NSC_5311036 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C16H18N2OS |
|---|
| Mol. Mass. | 286.392 |
|---|
| SMILES | CC(N)Cc1c[nH]c2ccc(OCc3cccs3)cc12 |
|---|
| Structure | 
|
|---|
Search and Browse
