| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 5-hydroxytryptamine 1D receptor |
|---|
| Ligand | BDBM50026045 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | 6150±n/a nM |
|---|
| Comments | PDSP_1593 |
|---|
| Citation |  Bymaster, FP; Calligaro, DO; Falcone, JF; Marsh, RD; Moore, NA; Tye, NC; Seeman, P; Wong, DT Radioreceptor binding profile of the atypical antipsychotic olanzapine. Neuropsychopharmacology14:87-96 (1996) [PubMed] Article |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| 5-hydroxytryptamine 1D receptor |
|---|
| Name: | 5-hydroxytryptamine 1D receptor |
|---|
| Synonyms: | 5-hydroxytryptamine 1D receptor (5HT1D) | HTR1D |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 12731.52 |
|---|
| Organism: | Bos taurus (Bovine) |
|---|
| Description: | Q8MI13 |
|---|
| Residue: | 119 |
|---|
| Sequence: | SNRSLNATATQGAWDPGTLQALKIALVVLLSIITLATVLSNAFVLTTIFLTRKLHTPANC
LIGSLAMTDLLVSILVMPISIAYTTTHTWSFGQLLCDIWLSSDITCCTASILHLCVIAL
|
|
|
|---|
| BDBM50026045 |
|---|
| n/a |
|---|
| Name | BDBM50026045 |
|---|
| Synonyms: | (R,S)-3-Bromo-N-(1-ethyl-pyrrolidin-2-ylmethyl)-2,6-dimethoxy-benzamide | (S)-3-Bromo-N-(1-ethyl-pyrrolidin-2-ylmethyl)-2,6-dimethoxy-benzamide | 3-Bromo-N-((R)-1-ethyl-pyrrolidin-2-ylmethyl)-2,6-dimethoxy-benzamide | 3-Bromo-N-((S)-1-ethyl-pyrrolidin-2-ylmethyl)-2,6-dimethoxy-benzamide | 3-Bromo-N-(1-ethyl-pyrrolidin-2-ylmethyl)-2,6-dimethoxy-benzamide | 3-Bromo-N-(1-ethyl-pyrrolidin-2-ylmethyl)-2,6-dimethoxy-benzamide (Remoxipride) | 3-Bromo-N-(1-ethyl-pyrrolidin-2-ylmethyl)-2,6-dimethoxy-benzamide(remoxipride) | CHEMBL22242 | REMOXIPRIDE |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C16H23BrN2O3 |
|---|
| Mol. Mass. | 371.269 |
|---|
| SMILES | CCN1CCC[C@H]1CNC(=O)c1c(OC)ccc(Br)c1OC |
|---|
| Structure | 
|
|---|
Search and Browse
