| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cholecystokinin |
|---|
| Ligand | BDBM82479 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | 1000±n/a nM |
|---|
| Comments | PDSP_1408 |
|---|
| Citation |  Schotte, A; Janssen, PF; Gommeren, W; Luyten, WH; Van Gompel, P; Lesage, AS; De Loore, K; Leysen, JE Risperidone compared with new and reference antipsychotic drugs: in vitro and in vivo receptor binding. Psychopharmacology (Berl)124:57-73 (1996) [PubMed] Article |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| Cholecystokinin |
|---|
| Name: | Cholecystokinin |
|---|
| Synonyms: | CCK | CCKN_PIG | Cholecystokinin B |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 12528.64 |
|---|
| Organism: | GUINEA PIG |
|---|
| Description: | Cholecystokinin B 0 GUINEA PIG::P01356 |
|---|
| Residue: | 114 |
|---|
| Sequence: | MNGGLCLCVLMAVLAAGTLAQPVPPADSAVPGAQEEEAHRRQLRAVQKVDGESRAHLGAL
LARYIQQARKAPSGRVSMIKNLQSLDPSHRISDRDYMGWMDFGRRSAEEYEYTS
|
|
|
|---|
| BDBM82479 |
|---|
| n/a |
|---|
| Name | BDBM82479 |
|---|
| Synonyms: | CAS_132539-06-1 | NSC_4585 | OLANZAPINE | USRE49340, Rank 2 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H20N4S |
|---|
| Mol. Mass. | 312.432 |
|---|
| SMILES | CN1CCN(CC1)C1=c2cc(C)sc2=Nc2ccccc2N1 |c:8,15| |
|---|
| Structure | 
|
|---|
Search and Browse
