Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetD(3) dopamine receptor
LigandBDBM26948
Substrate/Competitorn/a
Ki 3.9±n/a nM
CommentsPDSP_843
Citation Schotte AJanssen PFGommeren WLuyten WHVan Gompel PLesage ASDe Loore KLeysen JE Risperidone compared with new and reference antipsychotic drugs: in vitro and in vivo receptor binding. Psychopharmacology (Berl) 124:57-73 (1996) [PubMed]  Article
More Info.:Get all data from this article
 
D(3) dopamine receptor
Name:D(3) dopamine receptor
Synonyms:D2-like dopamine receptor | DOPAMINE D3 | DRD3 | Dopamine D3 receptor | Dopamine D3 receptor (D3) | Dopamine D3 receptor (D3R) | Dopamine receptor | Dopamine receptor (D3) | Dopamine receptor D3
Type:n/a
Mol. Mass.:44243.43
Organism:Homo sapiens (Human)
Description:n/a
Residue:400
Sequence:
MASLSQLSSHLNYTCGAENSTGASQARPHAYYALSYCALILAIVFGNGLVCMAVLKERAL
QTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFSRICCDVFVTLDVMMCTASILN
LCAISIDRYTAVVMPVHYQHGTGQSSCRRVALMITAVWVLAFAVSCPLLFGFNTTGDPTV
CSISNPDFVIYSSVVSFYLPFGVTVLVYARIYVVLKQRRRKRILTRQNSQCNSVRPGFPQ
QTLSPDPAHLELKRYYSICQDTALGGPGFQERGGELKREEKTRNSLSPTIAPKLSLEVRK
LSNGRLSTSLKLGPLQPRGVPLREKKATQMVAIVLGAFIVCWLPFFLTHVLNTHCQTCHV
SPELYSATTWLGYVNSALNPVIYTTFNIEFRKAFLKILSC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM26948
n/a
NameBDBM26948
Synonyms:8-[4,4-bis(4-fluorophenyl)butyl]-1-phenyl-1,3,8-triazaspiro[4.5]decan-4-one | CHEMBL46516 | FLUSPIRILENE | NCGC00015424 | cid_3396 | spiropiperidine analogue, 1
TypeSmall organic molecule
Emp. Form.C29H31F2N3O
Mol. Mass.475.5727
SMILESFc1ccc(cc1)C(CCCN1CCC2(CC1)N(CNC2=O)c1ccccc1)c1ccc(F)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: