Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCholinergic, muscarinic
LigandBDBM85035
Substrate/Competitorn/a
Ki 0.55±n/a nM
CommentsPDSP_1436
Citation Schotte AJanssen PFGommeren WLuyten WHVan Gompel PLesage ASDe Loore KLeysen JE Risperidone compared with new and reference antipsychotic drugs: in vitro and in vivo receptor binding. Psychopharmacology (Berl) 124:57-73 (1996) [PubMed]  Article
More Info.:Get all data from this article
 
Cholinergic, muscarinic
Name:Cholinergic, muscarinic
Synonyms:Beta-arrestin-1 | OPIATE Delta | PAF Platelet activating factor
Type:Enzyme Catalytic Domain
Mol. Mass.:46360.54
Organism:RABBIT
Description:Cholinergic, muscarinic 0 RABBIT::Q95223
Residue:410
Sequence:
MGDKGTRVFKKASPNGKLTVYLGKRGFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCA
FRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIP
PKLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGP
HPTAETTRLFLMSDKPLHLEASLDKEIYYHGEPIIVNVHVTNNTNKTVKKIKISVRQYAD
ICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNL
ASSTLMREGANREILGIIVSYKVKVKLVVSRGGDVAVELPFTLMHPKPKEEPPHREVPEN
ETPVDTNLIELDTNDDDIVFEDFARQRLKGMKDDKEEEDDVTGSPRLNDR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM85035
n/a
NameBDBM85035
Synonyms:CAS_65154-06-5 | PAF | bloodplatelet-activatingfactor
TypeSmall organic molecule
Emp. Form.C26H54NO7P
Mol. Mass.523.6832
SMILESCCCCCCCCCCCCCCCCOC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(C)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: